Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 9-2 (TVA92)

This Recombinant Human T cell receptor alpha variable 9-2 (TVA92) spans the amino acid sequence from region 21-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 9-2 TRAV9-2

UniProt

A0A087WT02

Expression Region

21-112

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DSVTQMEGPVTLSEEAFLTINCTYTATGYPSLFWYVQYPGEGLQLLLKATKADDKGSNKGFEATYRKETTSFHLEKGSVQVSDSAVYFCALS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

REEP5 Polyclonal Antibody, PerCP Conjugated
bs-9481R-PerCP 100 µL

REEP5 Polyclonal Antibody, PerCP Conjugated

Sign In for Pricing
View Details
ADAMTS7-IN-1
orb2665309-01 10 mg

ADAMTS7-IN-1

Sign In for Pricing
View Details
ADAMTS7-IN-1
orb2665309-02 50 mg

ADAMTS7-IN-1

Sign In for Pricing
View Details
Anti-MAP3KL4 MAP3K21 Antibody
A30507 100 µL

Anti-MAP3KL4 MAP3K21 Antibody

Sign In for Pricing
View Details
PLV3-CMV-SIRT1-HA-EF1a-mCherry-Blast Plasmid
PVT79432 2 µg

PLV3-CMV-SIRT1-HA-EF1a-mCherry-Blast Plasmid

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to 5'-Nucleotidase, Cytosolic III (NT5C3)
MBS2073670-01 0.1 mL

FITC-Linked Polyclonal Antibody to 5'-Nucleotidase, Cytosolic III (NT5C3)

Sign In for Pricing
View Details