Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 26-1 (TVAZ1)

This Recombinant Human T cell receptor alpha variable 26-1 (TVAZ1) spans the amino acid sequence from region 20-109. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 26-1 TRAV26-1

UniProt

A0A087WT03

Expression Region

20-109

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KTTQPTSMDCAEGRAANLPCNHSTISGNEYVYWYRQIHSQGPQYIIHGLKNNETNEMASLIITEDRKSSTLILPHATLRDTAVYYCIVRV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Colloidal Gold Conjugated Rabbit Affinity Purified Antibody to Sheep IgG,  30nm
GAF-551-30 1 mL

Colloidal Gold Conjugated Rabbit Affinity Purified Antibody to Sheep IgG, 30nm

Sign In for Pricing
View Details
KIRREL3 (Short Isoform 3) Mouse Monoclonal Antibody [Clone ID: N320/48]
75-282 100 µL

KIRREL3 (Short Isoform 3) Mouse Monoclonal Antibody [Clone ID: N320/48]

Sign In for Pricing
View Details
Hcn3 Mouse Monoclonal Antibody [Clone ID: N141/28]
75-175 100 µL

Hcn3 Mouse Monoclonal Antibody [Clone ID: N141/28]

Sign In for Pricing
View Details
NOLA1 (GAR1) Rabbit Polyclonal Antibody
TA369636 100 µL

NOLA1 (GAR1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
L-Arginine-13C6,15N4 Hydrochloride
TRC-A769504-25MG 25 mg

L-Arginine-13C6,15N4 Hydrochloride

Sign In for Pricing
View Details
Mouse Adam4 activation kit by CRISPRa
GA200068 1 Kit

Mouse Adam4 activation kit by CRISPRa

Sign In for Pricing
View Details