Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 26-1 (TVAZ1)

This Recombinant Human T cell receptor alpha variable 26-1 (TVAZ1) spans the amino acid sequence from region 20-109. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 26-1 TRAV26-1

UniProt

A0A087WT03

Expression Region

20-109

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KTTQPTSMDCAEGRAANLPCNHSTISGNEYVYWYRQIHSQGPQYIIHGLKNNETNEMASLIITEDRKSSTLILPHATLRDTAVYYCIVRV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTIP (PAXIP1) Human Gene Knockout Kit (CRISPR)
KN415446 1 Kit

PTIP (PAXIP1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human DENND2A activation kit by CRISPRa
GA109036 1 Kit

Human DENND2A activation kit by CRISPRa

Sign In for Pricing
View Details
Accuris qMAX Green One-Step RT-qPCR Kit, High Rox, 1000 reactions
PR2120-H-1000 1 Each

Accuris qMAX Green One-Step RT-qPCR Kit, High Rox, 1000 reactions

Sign In for Pricing
View Details
IVD (NM_002225) Human Over-expression Lysate
LC432239 20 µg

IVD (NM_002225) Human Over-expression Lysate

Sign In for Pricing
View Details
CD74 (LN-2 + CLIP/813), 0.2mg/mL
BNUB1207-500 1x 500 µL

CD74 (LN-2 + CLIP/813), 0.2mg/mL

Sign In for Pricing
View Details
Adenosine Monophosphate (mixture of 2’(3’)-phosphate isomers)
TRC-A281775-50MG 50 mg

Adenosine Monophosphate (mixture of 2’(3’)-phosphate isomers)

Sign In for Pricing
View Details