Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 16 (TVB16)

This Recombinant Human T cell receptor beta variable 16 (TVB16) spans the amino acid sequence from region 21-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 16 TRBV16

UniProt

A0A087WV62

Expression Region

21-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EEVAQTPKHLVRGEGQKAKLYCAPIKGHSYVFWYQQVLKNEFKFLISFQNENVFDETGMPKERFSAKCLPNSPCSLEIQATKLEDSAVYFCASSQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GLDC (N-term) Rabbit Polyclonal Antibody
AP51849PU-N 400 µL

GLDC (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant B2M/beta-2 microglobulin Monoclonal Antibody
AN300019P 100 µL

Recombinant B2M/beta-2 microglobulin Monoclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary
CS503861 5x 5 µm

Frozen Tissue Sections, Ovary

Sign In for Pricing
View Details
Recombinant Human GAL protein (GST tag)
PDEH100807-01 20 µg

Recombinant Human GAL protein (GST tag)

Sign In for Pricing
View Details
Recombinant Human GAL protein (GST tag)
PDEH100807-02 100 µg

Recombinant Human GAL protein (GST tag)

Sign In for Pricing
View Details
Recombinant Human GAL protein (GST tag)
PDEH100807-03 500 µg

Recombinant Human GAL protein (GST tag)

Sign In for Pricing
View Details