Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 16 (TVB16)

This Recombinant Human T cell receptor beta variable 16 (TVB16) spans the amino acid sequence from region 21-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 16 TRBV16

UniProt

A0A087WV62

Expression Region

21-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EEVAQTPKHLVRGEGQKAKLYCAPIKGHSYVFWYQQVLKNEFKFLISFQNENVFDETGMPKERFSAKCLPNSPCSLEIQATKLEDSAVYFCASSQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD168 (HMMR) (C-term) Rabbit Polyclonal Antibody
AP52063PU-N 400 µL

CD168 (HMMR) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Chromogranin A (LK2H10 + PHE5), CF568 conjugate, 0.1mg/mL
BNC680698-500 1x 500 µL

Chromogranin A (LK2H10 + PHE5), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TFIIF (GTF2F1) Rabbit Polyclonal Antibody
TA365887 100 µL

TFIIF (GTF2F1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
C3orf23 (TCAIM) (NM_173826) Human Recombinant Protein
TP324319 20 µg

C3orf23 (TCAIM) (NM_173826) Human Recombinant Protein

Sign In for Pricing
View Details
p21 Ras (HRAS) (NM_001130442) Human Over-expression Lysate
LC427210 20 µg

p21 Ras (HRAS) (NM_001130442) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Chaperonin Containing TCP1, Subunit 2 (CCT2) ELISA Kit
RD-CCT2-Mu-01 96 Tests

Mouse Chaperonin Containing TCP1, Subunit 2 (CCT2) ELISA Kit

Sign In for Pricing
View Details