Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional T cell receptor beta variable 17 (TVB17)

This Recombinant Human Probable non-functional T cell receptor beta variable 17 (TVB17) spans the amino acid sequence from region 20-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional T cell receptor beta variable 17 TRBV17

UniProt

A0A087X0K7

Expression Region

20-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EPGVSQTPRHKVTNMGQEVILRCDPSSGHMFVHWYRQNLRQEMKLLISFQYQNIAVDSGMPKERFTAERPNGTSSTLKIHPAEPRDSAVYLYSSG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human anti-human ovary (AoAb) IgM (HB)
E4A11C52-HB-M 50 µg

Human anti-human ovary (AoAb) IgM (HB)

Sign In for Pricing
View Details
IMMP2L-IT1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV729935 1.0 µg DNA

IMMP2L-IT1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Slc20a1 sgRNA CRISPR Lentivector set (Mouse)
K3719601 3x 1.0 µg

Slc20a1 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
Anti-GAS8 Antibody
CPA3226-01 30 µL

Anti-GAS8 Antibody

Sign In for Pricing
View Details
Anti-GAS8 Antibody
CPA3226-02 50 μL

Anti-GAS8 Antibody

Sign In for Pricing
View Details
Anti-GAS8 Antibody
CPA3226-03 100 µL

Anti-GAS8 Antibody

Sign In for Pricing
View Details