Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 18 (TVB18)

This Recombinant Human T cell receptor beta variable 18 (TVB18) spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 18 TRBV18

UniProt

A0A087X0M5

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVMQNPRHLVRRRGQEARLRCSPMKGHSHVYWYRQLPEEGLKFMVYLQKENIIDESGMPKERFSAEFPKEGPSILRIQQVVRGDSAAYFCASSP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF320 antibody
FNab09684 100 µg

ZNF320 antibody

Sign In for Pricing
View Details
UBE4B Recombinant Rabbit Monoclonal Antibody [JE55-76]
ET7111-11 100 µL

UBE4B Recombinant Rabbit Monoclonal Antibody [JE55-76]

Sign In for Pricing
View Details
Human IL-5 Recombinant Rabbit Monoclonal Antibody [PSH04-65] - BSA and Azide free (Detector)
HA722165 100 µL

Human IL-5 Recombinant Rabbit Monoclonal Antibody [PSH04-65] - BSA and Azide free (Detector)

Sign In for Pricing
View Details
ABIN3 (TNIP3) (NM_024873) Human Over-expression Lysate
LY403041 100 µg

ABIN3 (TNIP3) (NM_024873) Human Over-expression Lysate

Sign In for Pricing
View Details
ddx24 Recombinant Mouse Monoclonal Antibody [A3B10-R]
HA601183 100 µL

ddx24 Recombinant Mouse Monoclonal Antibody [A3B10-R]

Sign In for Pricing
View Details
Perforin-1 (Pore Forming Protein) (Apoptosis Marker) (PRF1/2470), 1mg/mL
BNUM2470-50 1x 50 µL

Perforin-1 (Pore Forming Protein) (Apoptosis Marker) (PRF1/2470), 1mg/mL

Sign In for Pricing
View Details