Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 2D-26 (KVD26)

This Recombinant Human Immunoglobulin kappa variable 2D-26 (KVD26) spans the amino acid sequence from region 21-120. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 2D-26 IGKV2D-26

UniProt

A0A0A0MRZ7

Expression Region

21-120

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EIVMTQTPLSLSITPGEQASMSCRSSQSLLHSDGYTYLYWFLQKARPVSTLLIYEVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDFGVYYCMQDAQDP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FSTL1 Protein (N-His, Human)
P504052 100 µg

FSTL1 Protein (N-His, Human)

Sign In for Pricing
View Details
PIP4K2B Protein (N-GST, Human)
P527618 100 µg

PIP4K2B Protein (N-GST, Human)

Sign In for Pricing
View Details
Rabbit Polyclonal p40 Antibody [DyLight 755]
NBP2-99500IR 0.1 mL

Rabbit Polyclonal p40 Antibody [DyLight 755]

Sign In for Pricing
View Details
Connexin 45 (GJC1, Gap Junction gamma-1 Protein, Connexin-45, Cx45, Gap Junction alpha-7 Protein, GJA7, DKFZp686P0738, Connexin-45, Cx45) (MaxLight 550)
MBS6400214-01 0.1 mL

Connexin 45 (GJC1, Gap Junction gamma-1 Protein, Connexin-45, Cx45, Gap Junction alpha-7 Protein, GJA7, DKFZp686P0738, Connexin-45, Cx45) (MaxLight 550)

Sign In for Pricing
View Details
Connexin 45 (GJC1, Gap Junction gamma-1 Protein, Connexin-45, Cx45, Gap Junction alpha-7 Protein, GJA7, DKFZp686P0738, Connexin-45, Cx45) (MaxLight 550)
MBS6400214-02 5x 0.1 mL

Connexin 45 (GJC1, Gap Junction gamma-1 Protein, Connexin-45, Cx45, Gap Junction alpha-7 Protein, GJA7, DKFZp686P0738, Connexin-45, Cx45) (MaxLight 550)

Sign In for Pricing
View Details
Beta-lactoglobulin Rabbit Polyclonal Antibody (PE)
orb495706 100 µL

Beta-lactoglobulin Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details