Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 5-52 (LV552)

This Recombinant Human Immunoglobulin lambda variable 5-52 (LV552) spans the amino acid sequence from region 20-124. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 5-52 IGLV5-52

UniProt

A0A0A0MRZ9

Expression Region

20-124

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QPVLTQPSSHSASSGASVRLTCMLSSGFSVGDFWIRWYQQKPGNPPRYLLYYHSDSNKGQGSGVPSRFSGSNDASANAGILRISGLQPEDEADYYCGTWHSNSKT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CNNM3 Human Pre-designed siRNA Set A
HY-RS02897 1 Set

CNNM3 Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
ORAI3 Antibody [1B4F1]
PM-4913-01mg 0.1 mg

ORAI3 Antibody [1B4F1]

Sign In for Pricing
View Details
Endorphin, alpha-Neo (Porcine) - I-125 Labeled
T-021-40 10 µCi

Endorphin, alpha-Neo (Porcine) - I-125 Labeled

Sign In for Pricing
View Details
CRMP1 Antibody
orb522228-01 50 μL

CRMP1 Antibody

Sign In for Pricing
View Details
CRMP1 Antibody
orb522228-02 100 µL

CRMP1 Antibody

Sign In for Pricing
View Details
ERCC6L2 Antibody - C-terminal region : FITC (ARP54402_P050-FITC)
ARP54402_P050-FITC 100 µL

ERCC6L2 Antibody - C-terminal region : FITC (ARP54402_P050-FITC)

Sign In for Pricing
View Details