Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional T cell receptor beta variable 5-3 (TVB53)

This Recombinant Human Probable non-functional T cell receptor beta variable 5-3 (TVB53) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional T cell receptor beta variable 5-3 TRBV5-3

UniProt

A0A0A0MS03

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQSPTHLIKTRGQQVTLRCSPISGHSSVSWYQQAPGQGPQFIFEYANELRRSEGNFPNRFSGRQFHDYCSEMNVSALELGDSALYLCARSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CHRM4, CT
501377 200 µL

CHRM4, CT

Sign In for Pricing
View Details
AKR1C1/C2 Rabbit Polyclonal Antibody (PE)
orb2617376 100 µg

AKR1C1/C2 Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
Gm5662 (NM_001013824) Mouse Tagged Lenti ORF Clone
MR219371L4 10 µg

Gm5662 (NM_001013824) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Mrpl51 Rat shRNA Lentiviral Particle (Locus ID 297601)
TL705198V 500 µL Each

Mrpl51 Rat shRNA Lentiviral Particle (Locus ID 297601)

Sign In for Pricing
View Details
ANGPTL3 (ANG-5, ANGPT5, Angiopoietin-5) (MaxLight 650)
MBS6404146-01 0.1 mL

ANGPTL3 (ANG-5, ANGPT5, Angiopoietin-5) (MaxLight 650)

Sign In for Pricing
View Details
ANGPTL3 (ANG-5, ANGPT5, Angiopoietin-5) (MaxLight 650)
MBS6404146-02 5x 0.1 mL

ANGPTL3 (ANG-5, ANGPT5, Angiopoietin-5) (MaxLight 650)

Sign In for Pricing
View Details