Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional T cell receptor beta variable 6-7 (TVB67)

This Recombinant Human Probable non-functional T cell receptor beta variable 6-7 (TVB67) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional T cell receptor beta variable 6-7 TRBV6-7

UniProt

A0A0A0MS04

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQTPKFHVLKTGQSMTLLCAQDMNHEYMYRYRQDPGKGLRLIYYSVAAALTDKGEVPNGYNVSRSNTEDFPLKLESAAPSQTSVYFCASSY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PASK Double Nickase Plasmid (m)
sc-435323-NIC 20 µg

PASK Double Nickase Plasmid (m)

Sign In for Pricing
View Details
H2AFX sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K0925307 1.0 µg DNA

H2AFX sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
PGBD5 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
36491111 3x 1.0 µg

PGBD5 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Recombinant Mycobacterium Tuberculosis Rv1480 Protein (aa 1-317)
VAng-Yyj0225-50gEcoli 50 µg (E. coli)

Recombinant Mycobacterium Tuberculosis Rv1480 Protein (aa 1-317)

Sign In for Pricing
View Details
Septin 8 Rabbit pAb, PerCP-Cy7 conjugated
orb2871074 100 µL

Septin 8 Rabbit pAb, PerCP-Cy7 conjugated

Sign In for Pricing
View Details
COL11A2 siRNA (Mouse)
MBS8236049-01 15 nmol

COL11A2 siRNA (Mouse)

Sign In for Pricing
View Details