Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional T cell receptor beta variable 5-7 (TVB57)

This Recombinant Human Probable non-functional T cell receptor beta variable 5-7 (TVB57) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional T cell receptor beta variable 5-7 TRBV5-7

UniProt

A0A0A0MS05

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQSPTHLIKTRGQHVTLRCSPISGHTSVSSYQQALGQGPQFIFQYYEKEERGRGNFPDQFSGHQFPNYSSELNVNALLLGDSALYLCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Gys1 shRNA (UAS) - Lentiviral mouse Gys1 shRNA (UAS, iRFP) (25)
GTR15239918 1 Vial

Lentiviral mouse Gys1 shRNA (UAS) - Lentiviral mouse Gys1 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
FHL-5 shRNA Plasmid (m)
sc-140839-SH 20 µg

FHL-5 shRNA Plasmid (m)

Sign In for Pricing
View Details
MCT5 Polyclonal Antibody, APC Conjugated
bs-18736R-APC 100 µL

MCT5 Polyclonal Antibody, APC Conjugated

Sign In for Pricing
View Details
Anti-CD205 (oberotatug biosimilar) mAb
MBS1881474-01 0.05 mg

Anti-CD205 (oberotatug biosimilar) mAb

Sign In for Pricing
View Details
Anti-CD205 (oberotatug biosimilar) mAb
MBS1881474-02 0.1 mg

Anti-CD205 (oberotatug biosimilar) mAb

Sign In for Pricing
View Details
Anti-CD205 (oberotatug biosimilar) mAb
MBS1881474-03 5x 0.1 mg

Anti-CD205 (oberotatug biosimilar) mAb

Sign In for Pricing
View Details