Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 1-45 (HV145)

This Recombinant Human Immunoglobulin heavy variable 1-45 (HV145) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 1-45 IGHV1-45

UniProt

A0A0A0MS14

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QMQLVQSGAEVKKTGSSVKVSCKASGYTFTYRYLHWVRQAPGQALEWMGWITPFNGNTNYAQKFQDRVTITRDRSMSTAYMELSSLRSEDTAMYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RNF19A Antibody
25-832 100 µL

RNF19A Antibody

Sign In for Pricing
View Details
Mouse Monoclonal Antibody to MAP1LC3A
MBS8575516-01 0.1 mL

Mouse Monoclonal Antibody to MAP1LC3A

Sign In for Pricing
View Details
Mouse Monoclonal Antibody to MAP1LC3A
MBS8575516-02 0.1 mL (AF405L)

Mouse Monoclonal Antibody to MAP1LC3A

Sign In for Pricing
View Details
Mouse Monoclonal Antibody to MAP1LC3A
MBS8575516-03 0.1 mL (AF405S)

Mouse Monoclonal Antibody to MAP1LC3A

Sign In for Pricing
View Details
Mouse Monoclonal Antibody to MAP1LC3A
MBS8575516-04 0.1 mL (AF610)

Mouse Monoclonal Antibody to MAP1LC3A

Sign In for Pricing
View Details
Mouse Monoclonal Antibody to MAP1LC3A
MBS8575516-05 0.1 mL (AF635)

Mouse Monoclonal Antibody to MAP1LC3A

Sign In for Pricing
View Details