Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 3-49 (HV349)

This Recombinant Human Immunoglobulin heavy variable 3-49 (HV349) spans the amino acid sequence from region 20-119. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 3-49 IGHV3-49

UniProt

A0A0A0MS15

Expression Region

20-119

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESGGGLVQPGRSLRLSCTASGFTFGDYAMSWVRQAPGKGLEWVGFIRSKAYGGTTEYAASVKGRFTISRDDSKSIAYLQMNSLKTEDTAVYYCTR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Triticum vulgaris Lectin (WGA) - Separopore® 4B
20181018-1 1 mL

Triticum vulgaris Lectin (WGA) - Separopore® 4B

Sign In for Pricing
View Details
Ms4a1 Rat siRNA Oligo Duplex (Locus ID 309217)
SR506958 1 Kit

Ms4a1 Rat siRNA Oligo Duplex (Locus ID 309217)

Sign In for Pricing
View Details
IL1RA Rabbit pAb
E45R22973N-100 100 µL

IL1RA Rabbit pAb

Sign In for Pricing
View Details
Inhibitor hsa-miR-4653-5p AAV miRNA Vector
Amh3157900 500 ng

Inhibitor hsa-miR-4653-5p AAV miRNA Vector

Sign In for Pricing
View Details
Polyclonal GPR161 antibody - middle region
APR16518G 0.05mg

Polyclonal GPR161 antibody - middle region

Sign In for Pricing
View Details
Mouse Olfactory receptor 2H1 (OR2H1) ELISA Kit
GTR10355475 96 Well

Mouse Olfactory receptor 2H1 (OR2H1) ELISA Kit

Sign In for Pricing
View Details