Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 3-49 (HV349)

This Recombinant Human Immunoglobulin heavy variable 3-49 (HV349) spans the amino acid sequence from region 20-119. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 3-49 IGHV3-49

UniProt

A0A0A0MS15

Expression Region

20-119

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESGGGLVQPGRSLRLSCTASGFTFGDYAMSWVRQAPGKGLEWVGFIRSKAYGGTTEYAASVKGRFTISRDDSKSIAYLQMNSLKTEDTAVYYCTR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPR176 Antibody
ABD4887 100 µg

GPR176 Antibody

Sign In for Pricing
View Details
ELOVL7, CT (ELOVL7, Elongation of very long chain fatty acids protein 7, 3-keto acyl-CoA synthase ELOVL7, ELOVL fatty acid elongase 7) (AP) discontinued
035053-AP 200 µL

ELOVL7, CT (ELOVL7, Elongation of very long chain fatty acids protein 7, 3-keto acyl-CoA synthase ELOVL7, ELOVL fatty acid elongase 7) (AP) discontinued

Sign In for Pricing
View Details
Fab Goat IgG (H&L) Antibody Fluorescein Conjugated
orb348423 500 μL

Fab Goat IgG (H&L) Antibody Fluorescein Conjugated

Sign In for Pricing
View Details
IQCF6 Protein Vector (Human) (pPM-C-His)
PV087825 500 ng

IQCF6 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Norovirus VP1 (Norovirus VP-1) (HRP) discontinued
227101-HRP 100 µL

Norovirus VP1 (Norovirus VP-1) (HRP) discontinued

Sign In for Pricing
View Details
ELISA Kit For Collagen alpha-2 (XI) chain
E9532h 96 Tests

ELISA Kit For Collagen alpha-2 (XI) chain

Sign In for Pricing
View Details