Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 3-49 (HV349)

This Recombinant Human Immunoglobulin heavy variable 3-49 (HV349) spans the amino acid sequence from region 20-119. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 3-49 IGHV3-49

UniProt

A0A0A0MS15

Expression Region

20-119

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESGGGLVQPGRSLRLSCTASGFTFGDYAMSWVRQAPGKGLEWVGFIRSKAYGGTTEYAASVKGRFTISRDDSKSIAYLQMNSLKTEDTAVYYCTR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-Human CPT2 pAb
PA6066-01 50 μL

Rabbit Anti-Human CPT2 pAb

Sign In for Pricing
View Details
Rabbit Anti-Human CPT2 pAb
PA6066-02 100 μL

Rabbit Anti-Human CPT2 pAb

Sign In for Pricing
View Details
GENLISA Rabbit Anti Keyhole Limpet Hemocyanin IgG (Anti-KLH IgG) ELISA
KLX1027 1x 96 Well

GENLISA Rabbit Anti Keyhole Limpet Hemocyanin IgG (Anti-KLH IgG) ELISA

Sign In for Pricing
View Details
Moxidectin
sc-224098 25 mg

Moxidectin

Sign In for Pricing
View Details
RN7SK AAV siRNA Pooled Vector
40173161 1.0 µg

RN7SK AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Human Tissue-type plasminogen activator ELISA Kit
orb1662341 96 Tests

Human Tissue-type plasminogen activator ELISA Kit

Sign In for Pricing
View Details