Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 6D-21 (KVD21)

This Recombinant Human Immunoglobulin kappa variable 6D-21 (KVD21) spans the amino acid sequence from region 20-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 6D-21 IGKV6D-21

UniProt

A0A0A0MT36

Expression Region

20-114

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EIVLTQSPDFQSVTPKEKVTITCRASQSIGSSLHWYQQKPDQSPKLLIKYASQSISGVPSRFSGSGSGTDFTLTINSLEAEDAAAYYCHQSSSLP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Tgfbrap1 Pre-designed siRNA Set A
SI214463A 1 Each

Rat Tgfbrap1 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Biotinylated Anti-CTLA-4 (tazlestobart biosimilar) mAb
12-90333B-50 50 µg

Biotinylated Anti-CTLA-4 (tazlestobart biosimilar) mAb

Sign In for Pricing
View Details
RASA4B CRISPR Activation Plasmid (h)
sc-418861-ACT 20 µg

RASA4B CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
NAMPT Knockout HEK293 Polyclonal Cells
ARG12746 1 Million

NAMPT Knockout HEK293 Polyclonal Cells

Sign In for Pricing
View Details
NGF Antibody
R12-2264-01 50 μL

NGF Antibody

Sign In for Pricing
View Details
NGF Antibody
R12-2264-02 100 µL

NGF Antibody

Sign In for Pricing
View Details