Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 13 (TVB13)

This Recombinant Human T cell receptor beta variable 13 (TVB13) spans the amino acid sequence from region 32-124. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 13 TRBV13

UniProt

A0A0A6YYD4

Expression Region

32-124

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVIQSPRHLIKEKRETATLKCYPIPRHDTVYWYQQGPGQDPQFLISFYEKMQSDKGSIPDRFSAQQFSDYHSELNMSSLELGDSALYFCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Prostate
CS706978 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
C1QA / Complement C1q A-Chain (C1QA/2955), CF488A conjugate, 0.1mg/mL
BNC882955-100 1x 100 µL

C1QA / Complement C1q A-Chain (C1QA/2955), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SIX6OS1 (C14orf39) Human Gene Knockout Kit (CRISPR)
KN421322 1 Kit

SIX6OS1 (C14orf39) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
p63 Recombinant Rabbit Monoclonal Antibody [JE53-53]
ET7110-47 100 µL

p63 Recombinant Rabbit Monoclonal Antibody [JE53-53]

Sign In for Pricing
View Details
Cytokeratin 19 (Pancreatic Stem Cell Marker) (rKRT19/800), CF640R conjugate, 0.1mg/mL
BNC401958-500 1x 500 µL

Cytokeratin 19 (Pancreatic Stem Cell Marker) (rKRT19/800), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Serpinb3b Mouse Gene Knockout Kit (CRISPR)
KN515584 1 Kit

Serpinb3b Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details