Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 13 (TVB13)

This Recombinant Human T cell receptor beta variable 13 (TVB13) spans the amino acid sequence from region 32-124. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 13 TRBV13

UniProt

A0A0A6YYD4

Expression Region

32-124

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVIQSPRHLIKEKRETATLKCYPIPRHDTVYWYQQGPGQDPQFLISFYEKMQSDKGSIPDRFSAQQFSDYHSELNMSSLELGDSALYFCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NDP (NM_000266) Human Over-expression Lysate
LC424827 20 µg

NDP (NM_000266) Human Over-expression Lysate

Sign In for Pricing
View Details
16S V5-V7 Library Preparation Kit for Illumina (Set B)
70820 96 Preparations

16S V5-V7 Library Preparation Kit for Illumina (Set B)

Sign In for Pricing
View Details
SIGLEC1 / CD169 / Sialoadhesin (HSn 7D2), CF740 conjugate, 0.1mg/mL
BNC742843-500 1x 500 µL

SIGLEC1 / CD169 / Sialoadhesin (HSn 7D2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CSF-1-R Recombinant Rabbit Monoclonal Antibody [PD00-45]
HA721180 100 µL

CSF-1-R Recombinant Rabbit Monoclonal Antibody [PD00-45]

Sign In for Pricing
View Details
ARF1 (Golgi Apparatus Marker) (1A9/5), CF640R conjugate, 0.1mg/mL
BNC402028-100 1x 100 µL

ARF1 (Golgi Apparatus Marker) (1A9/5), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Factor V (F5) Rabbit Polyclonal Antibody
TA372533 100 µL

Factor V (F5) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details