Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 6-6 (TVB66)

This Recombinant Human T cell receptor beta variable 6-6 (TVB66) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 6-6 TRBV6-6

UniProt

A0A0A6YYG2

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQTPKFRILKIGQSMTLQCAQDMNHNYMYWYRQDPGMGLKLIYYSVGAGITDKGEVPNGYNVSRSTTEDFPLRLELAAPSQTSVYFCASSY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3-Methylcyclobutan-1-one
BAA19208-01 50 mg

3-Methylcyclobutan-1-one

Sign In for Pricing
View Details
3-Methylcyclobutan-1-one
BAA19208-02 0.5 g

3-Methylcyclobutan-1-one

Sign In for Pricing
View Details
CR2 Antibody (FITC)
orb1272091 25 Tests

CR2 Antibody (FITC)

Sign In for Pricing
View Details
Phospho CACNB2 Antibody BIOTIN-Conjugated
MBS542598-01 0.1 mg

Phospho CACNB2 Antibody BIOTIN-Conjugated

Sign In for Pricing
View Details
Phospho CACNB2 Antibody BIOTIN-Conjugated
MBS542598-02 5x 0.1 mg

Phospho CACNB2 Antibody BIOTIN-Conjugated

Sign In for Pricing
View Details
CaiE Antibody
orb810920 2 mg

CaiE Antibody

Sign In for Pricing
View Details