Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 8-3 (TVA83)

This Recombinant Human T cell receptor alpha variable 8-3 (TVA83) spans the amino acid sequence from region 21-113. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 8-3 TRAV8-3

UniProt

A0A0A6YYJ7

Expression Region

21-113

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QSVTQPDIHITVSEGASLELRCNYSYGATPYLFWYVQSPGQGLQLLLKYFSGDTLVQGIKGFEAEFKRSQSSFNLRKPSVHWSDAAEYFCAVG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pcmtd2 Mouse siRNA Oligo Duplex (Locus ID 245867)
SR412100 1 Kit

Pcmtd2 Mouse siRNA Oligo Duplex (Locus ID 245867)

Sign In for Pricing
View Details
Chromosome transmission fidelity protein 8 homolog isoform 2 (CHTF8) Rat ELISA Kit
C3654 96 Tests

Chromosome transmission fidelity protein 8 homolog isoform 2 (CHTF8) Rat ELISA Kit

Sign In for Pricing
View Details
Lentiviral human C11orf87 shRNA (UAS) - Lentiviral human C11orf87 shRNA (UAS, GFP) (25)
GTR15117056 1 Vial

Lentiviral human C11orf87 shRNA (UAS) - Lentiviral human C11orf87 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
ZNF174 (NM_001032292) Human Over-expression Lysate
LC422302 20 µg

ZNF174 (NM_001032292) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Hepc 25 (Hepcidin 25) ELISA Kit
EKF58761 96 Tests

Mouse Hepc 25 (Hepcidin 25) ELISA Kit

Sign In for Pricing
View Details
BICC1 Protein Vector (Mouse) (pPB-C-His)
PV159414 500 ng

BICC1 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details