Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 8-1 (TVA81)

This Recombinant Human T cell receptor alpha variable 8-1 (TVA81) spans the amino acid sequence from region 21-113. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 8-1 TRAV8-1

UniProt

A0A0A6YYK1

Expression Region

21-113

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QSVSQHNHHVILSEAASLELGCNYSYGGTVNLFWYVQYPGQHLQLLLKYFSGDPLVKGIKGFEAEFIKSKFSFNLRKPSVQWSDTAEYFCAVN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Icatibant (1-5) Trifluoroacetic Acid Salt
TRC-I163755-2.5MG 2.5 mg

Icatibant (1-5) Trifluoroacetic Acid Salt

Sign In for Pricing
View Details
1-(4-Chlorophenyl)cyclobutane-d6 Carbonitrile
TRC-C379512-10MG 10 mg

1-(4-Chlorophenyl)cyclobutane-d6 Carbonitrile

Sign In for Pricing
View Details
4-Phenylphenol-13C6
TRC-P336137-10MG 10 mg

4-Phenylphenol-13C6

Sign In for Pricing
View Details
Ultrasonic Cleaner BULC-911
BULC-911 1 Unit

Ultrasonic Cleaner BULC-911

Sign In for Pricing
View Details
GFAP (GA-5 + ASTRO/789), CF594 conjugate, 0.1mg/mL
BNC940898-500 1x 500 µL

GFAP (GA-5 + ASTRO/789), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1.2 (HIST1H1C) (NM_005319) Human Over-expression Lysate
LY401640 100 µg

Histone H1.2 (HIST1H1C) (NM_005319) Human Over-expression Lysate

Sign In for Pricing
View Details