Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 8-1 (TVA81)

This Recombinant Human T cell receptor alpha variable 8-1 (TVA81) spans the amino acid sequence from region 21-113. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 8-1 TRAV8-1

UniProt

A0A0A6YYK1

Expression Region

21-113

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QSVSQHNHHVILSEAASLELGCNYSYGGTVNLFWYVQYPGQHLQLLLKYFSGDPLVKGIKGFEAEFIKSKFSFNLRKPSVQWSDTAEYFCAVN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOXRED2 (NM_001102371) Human Over-expression Lysate
LC420137 20 µg

FOXRED2 (NM_001102371) Human Over-expression Lysate

Sign In for Pricing
View Details
Anti-Histone H2A.X (Ab-139)
Y021260 100 µg

Anti-Histone H2A.X (Ab-139)

Sign In for Pricing
View Details
HSP40 Antibody
8C0232-AAT 50 µg

HSP40 Antibody

Sign In for Pricing
View Details
HADHSC Mouse Monoclonal Antibody [D10-E7]
M1409-2 100 µL

HADHSC Mouse Monoclonal Antibody [D10-E7]

Sign In for Pricing
View Details
P21 / WAF1 (WA-1), CF640R conjugate, 0.1mg/mL
BNC400043-500 1x 500 µL

P21 / WAF1 (WA-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue Total RNA, Kidney
CR562730 5 µg

Tissue Total RNA, Kidney

Sign In for Pricing
View Details