Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 8-1 (TVA81)

This Recombinant Human T cell receptor alpha variable 8-1 (TVA81) spans the amino acid sequence from region 21-113. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 8-1 TRAV8-1

UniProt

A0A0A6YYK1

Expression Region

21-113

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QSVSQHNHHVILSEAASLELGCNYSYGGTVNLFWYVQYPGQHLQLLLKYFSGDPLVKGIKGFEAEFIKSKFSFNLRKPSVQWSDTAEYFCAVN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Alpha-Fetoprotein Lens Culinaris Agglutinin 2 (aFPL2) ELISA Kit
QY-E02914 96 Tests

Human Alpha-Fetoprotein Lens Culinaris Agglutinin 2 (aFPL2) ELISA Kit

Sign In for Pricing
View Details
S- (-) -Raclopride (Dopamine Receptor D2 Antagonist, S-Raclopride, Raclopride)
217765 10 mg

S- (-) -Raclopride (Dopamine Receptor D2 Antagonist, S-Raclopride, Raclopride)

Sign In for Pricing
View Details
Porcine Anti-trypsin (AT) ELISA Kit
NSL1482Po 96 Tests

Porcine Anti-trypsin (AT) ELISA Kit

Sign In for Pricing
View Details
DBF4 Protein Vector (Rat) (pPB-N-His)
PV263143 500 ng

DBF4 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
splicing factor 1 (SF1) (NM_001178030) Human Tagged ORF Clone Lentiviral Particle
RC230417L4V 200 µL

splicing factor 1 (SF1) (NM_001178030) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
C4, Recombinant, Rat, His-Tag discontinued
590753-01 20 µg

C4, Recombinant, Rat, His-Tag discontinued

Sign In for Pricing
View Details