Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 16 (TVA16)

This Recombinant Human T cell receptor alpha variable 16 (TVA16) spans the amino acid sequence from region 21-109. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 16 TRAV16

UniProt

A0A0A6YYK6

Expression Region

21-109

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QRVTQPEKLLSVFKGAPVELKCNYSYSGSPELFWYVQYSRQRLQLLLRHISRESIKGFTADLNKGETSFHLKKPFAQEEDSAMYYCALS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1,2-Dichloropropane
89992659 100 g

1,2-Dichloropropane

Sign In for Pricing
View Details
CD34 polyclonal antibody
BS90235 50ul

CD34 polyclonal antibody

Sign In for Pricing
View Details
ADAMTS3-set siRNA/shRNA/RNAi Lentivector (Human)
11361091 4x 500 ng

ADAMTS3-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
RAB14 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated
bs-2933R-BF405 100 µL

RAB14 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
TMEM151B Antibody (N-term) Blocking peptide
MBS9218256-01 0.5 mg

TMEM151B Antibody (N-term) Blocking peptide

Sign In for Pricing
View Details
TMEM151B Antibody (N-term) Blocking peptide
MBS9218256-02 5x 0.5 mg

TMEM151B Antibody (N-term) Blocking peptide

Sign In for Pricing
View Details