Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 19 (TVA19)

This Recombinant Human T cell receptor alpha variable 19 (TVA19) spans the amino acid sequence from region 22-116. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 19; T-cell receptor alpha chain V region HPB-MLT; TRAV19

UniProt

A0A0A6YYK7

Expression Region

22-116

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QKVTQAQTEISVVEKEDVTLDCVYETRDTTYYLFWYKQPPSGELVFLIRRNSFDEQNEISGRYSWNFQKSTSSFNFTITASQVVDSAVYFCALSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CYB561D1 Antibody
C12081-01 50 μL

CYB561D1 Antibody

Sign In for Pricing
View Details
CYB561D1 Antibody
C12081-02 100 µL

CYB561D1 Antibody

Sign In for Pricing
View Details
SARS-CoV-2 RBD Antibody (Reference antibody)
E55B0236 100 µg

SARS-CoV-2 RBD Antibody (Reference antibody)

Sign In for Pricing
View Details
POGLUT1 Rabbit pAb
E45R23946N 50 ul

POGLUT1 Rabbit pAb

Sign In for Pricing
View Details
MB Polyclonal Antibody
ANT-13146-100ug 100 µg

MB Polyclonal Antibody

Sign In for Pricing
View Details
PathScan® Phospho-Lck (Tyr505) Sandwich ELISA Kit
CST 7941V4 50 Kits

PathScan® Phospho-Lck (Tyr505) Sandwich ELISA Kit

Sign In for Pricing
View Details