Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 3-15 (HV315)

This Recombinant Human Immunoglobulin heavy variable 3-15 (HV315) spans the amino acid sequence from region 20-119. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 3-15 IGHV3-15

UniProt

A0A0B4J1V0

Expression Region

20-119

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESGGGLVKPGGSLRLSCAASGFTFSNAWMSWVRQAPGKGLEWVGRIKSKTDGGTTDYAAPVKGRFTISRDDSKNTLYLQMNSLKTEDTAVYYCTT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF451 Human Gene Knockout Kit (CRISPR)
KN415720 1 Kit

ZNF451 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Slc25a15 Mouse Gene Knockout Kit (CRISPR)
KN515960 1 Kit

Slc25a15 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TTF1 (NKX2-1) Mouse Monoclonal Antibody [Clone ID: OTI4F1]
CF808371 100 µg

TTF1 (NKX2-1) Mouse Monoclonal Antibody [Clone ID: OTI4F1]

Sign In for Pricing
View Details
Human Von Willebrand Factor/vWF, Tag Free
HA210992-01 Inquire

Human Von Willebrand Factor/vWF, Tag Free

Sign In for Pricing
View Details
Human Von Willebrand Factor/vWF, Tag Free
HA210992-02 50 µg

Human Von Willebrand Factor/vWF, Tag Free

Sign In for Pricing
View Details
Human Von Willebrand Factor/vWF, Tag Free
HA210992-03 100 µg

Human Von Willebrand Factor/vWF, Tag Free

Sign In for Pricing
View Details