Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 3-15 (HV315)

This Recombinant Human Immunoglobulin heavy variable 3-15 (HV315) spans the amino acid sequence from region 20-119. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 3-15 IGHV3-15

UniProt

A0A0B4J1V0

Expression Region

20-119

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESGGGLVKPGGSLRLSCAASGFTFSNAWMSWVRQAPGKGLEWVGRIKSKTDGGTTDYAAPVKGRFTISRDDSKNTLYLQMNSLKTEDTAVYYCTT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Elab Fluor® Red 780 Anti-Mouse Ly-6G/Ly-6C (Gr-1) Antibody[RB6-8C5]
E-AB-F1120US-01 25 µg

Elab Fluor® Red 780 Anti-Mouse Ly-6G/Ly-6C (Gr-1) Antibody[RB6-8C5]

Sign In for Pricing
View Details
Elab Fluor® Red 780 Anti-Mouse Ly-6G/Ly-6C (Gr-1) Antibody[RB6-8C5]
E-AB-F1120US-02 100 µg

Elab Fluor® Red 780 Anti-Mouse Ly-6G/Ly-6C (Gr-1) Antibody[RB6-8C5]

Sign In for Pricing
View Details
HA Tag (16.43), 1mg/mL
BNUM2543-50 1x 50 µL

HA Tag (16.43), 1mg/mL

Sign In for Pricing
View Details
3-Chlorobisphenol A
TRC-C364580-5MG 5 mg

3-Chlorobisphenol A

Sign In for Pricing
View Details
CD79a (B-Cell Marker) (rIGA/764), 0.2mg/mL
BNUB1862-500 1x 500 µL

CD79a (B-Cell Marker) (rIGA/764), 0.2mg/mL

Sign In for Pricing
View Details
SOX17 Human Gene Knockout Kit (CRISPR)
KN220888LP 1 Kit

SOX17 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details