Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 2-26 (HV226)

This Recombinant Human Immunoglobulin heavy variable 2-26 (HV226) spans the amino acid sequence from region 20-119. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 2-26 IGHV2-26

UniProt

A0A0B4J1V2

Expression Region

20-119

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVTLKESGPVLVKPTETLTLTCTVSGFSLSNARMGVSWIRQPPGKALEWLAHIFSNDEKSYSTSLKSRLTISKDTSKSQVVLTMTNMDPVDTATYYCARI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GSTA3 (Glutathione S-transferase A3, GST Class-alpha Member 3, Glutathione S-transferase A3-3, MGC22232) (MaxLight 650)
MBS6380382-01 0.1 mL

GSTA3 (Glutathione S-transferase A3, GST Class-alpha Member 3, Glutathione S-transferase A3-3, MGC22232) (MaxLight 650)

Sign In for Pricing
View Details
GSTA3 (Glutathione S-transferase A3, GST Class-alpha Member 3, Glutathione S-transferase A3-3, MGC22232) (MaxLight 650)
MBS6380382-02 5x 0.1 mL

GSTA3 (Glutathione S-transferase A3, GST Class-alpha Member 3, Glutathione S-transferase A3-3, MGC22232) (MaxLight 650)

Sign In for Pricing
View Details
TMEM61 Antibody (Biotin)
abx305708-01 20 µg

TMEM61 Antibody (Biotin)

Sign In for Pricing
View Details
TMEM61 Antibody (Biotin)
abx305708-02 50 µg

TMEM61 Antibody (Biotin)

Sign In for Pricing
View Details
TMEM61 Antibody (Biotin)
abx305708-03 100 µg

TMEM61 Antibody (Biotin)

Sign In for Pricing
View Details
TMEM61 Antibody (Biotin)
abx305708-04 200 µg

TMEM61 Antibody (Biotin)

Sign In for Pricing
View Details