Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 2-26 (HV226)

This Recombinant Human Immunoglobulin heavy variable 2-26 (HV226) spans the amino acid sequence from region 20-119. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 2-26 IGHV2-26

UniProt

A0A0B4J1V2

Expression Region

20-119

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVTLKESGPVLVKPTETLTLTCTVSGFSLSNARMGVSWIRQPPGKALEWLAHIFSNDEKSYSTSLKSRLTISKDTSKSQVVLTMTNMDPVDTATYYCARI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD138 Recombinant Antibody, AbBy Fluor™ 647 Conjugated
bsm-60902R-BF647 100 µL

CD138 Recombinant Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
Cypermethrin [CAS:52315-07-8] 10 ug/ml in Acetonitrile
P875090 10 mL

Cypermethrin [CAS:52315-07-8] 10 ug/ml in Acetonitrile

Sign In for Pricing
View Details
Tyrosine-protein kinase CSK
AP82482 1 mg

Tyrosine-protein kinase CSK

Sign In for Pricing
View Details
RAD1, ID (RAD1, REC1, Cell cycle checkpoint protein RAD1, DNA repair exonuclease rad1 homolog, Rad1-like DNA damage checkpoint protein) (MaxLight 750)
MBS6339952-01 0.1 mL

RAD1, ID (RAD1, REC1, Cell cycle checkpoint protein RAD1, DNA repair exonuclease rad1 homolog, Rad1-like DNA damage checkpoint protein) (MaxLight 750)

Sign In for Pricing
View Details
RAD1, ID (RAD1, REC1, Cell cycle checkpoint protein RAD1, DNA repair exonuclease rad1 homolog, Rad1-like DNA damage checkpoint protein) (MaxLight 750)
MBS6339952-02 5x 0.1 mL

RAD1, ID (RAD1, REC1, Cell cycle checkpoint protein RAD1, DNA repair exonuclease rad1 homolog, Rad1-like DNA damage checkpoint protein) (MaxLight 750)

Sign In for Pricing
View Details
Ephrin A5 Protein, Rhesus, Recombinant (His Tag)
PK54260M2 200 µg

Ephrin A5 Protein, Rhesus, Recombinant (His Tag)

Sign In for Pricing
View Details