Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ABHD14B, Human (His)

ABHD14B Protein, identified as an atypical protein-lysine deacetylase, catalyzes lysine deacetylation using CoA as a substrate in vitro, generating acetyl-CoA and free amine. Although confirmation of in vivo deacetylase activity is needed, ABHD14B also exhibits hydrolase activity toward various p-nitrophenyl substrates. It may potentially activate transcription. ABHD14B Protein, Human (His) is the recombinant human-derived ABHD14B protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

ABHD14B Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/abhd14b-protein-human-his.html

Purity

96.60

Smiles

MAASVEQREGTIQVQGQALFFREALPGSGQARFSVLLLHGIRFSSETWQNLGTLHRLAQAGYRAVAIDLPGLGHSKEAAAPAPIGELAPGSFLAAVVDALELGPPVVISPSLSGMYSLPFLTAPGSQLPGFVPVAPICTDKINAANYASVKTPALIVYGDQDPMGQTSFEHLKQLPNHRVLIMKGAGHPCYLDKPEEWHTGLLDFLQGLQ

Molecular Formula

84836 (Gene_ID) Q96IU4-1 (M1-Q210) (Accession)

Molecular Weight

Approximately 24 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

RHG36 rabbit pAb
RA29391-01 50 µL

RHG36 rabbit pAb

Ask
View Details
RHG36 rabbit pAb
RA29391-02 100 µL

RHG36 rabbit pAb

Ask
View Details
Recombinant Human SCAPER Protein - (Dry Ice)
H00049855-P01-25ug 25 µg

Recombinant Human SCAPER Protein - (Dry Ice)

Ask
View Details
Pyruvate Kinase, Isozymes M1/M2, CT (L398) (PKM2, Pyruvate Kinase Muscle Isozyme, Cytosolic Thyroid Hormone-binding Protein, CTHBP, Opa-interacting Protein 3, OIP-3, Pyruvate Kinase 2/3, Thyroid Hormone-binding Protein 1, THBP1, Tumor M2-PK, p58, PKM, OIP3, PK2, PK3) (MaxLight 650) discontinued
P9545-31K-ML650 100 µL

Pyruvate Kinase, Isozymes M1/M2, CT (L398) (PKM2, Pyruvate Kinase Muscle Isozyme, Cytosolic Thyroid Hormone-binding Protein, CTHBP, Opa-interacting Protein 3, OIP-3, Pyruvate Kinase 2/3, Thyroid Hormone-binding Protein 1, THBP1, Tumor M2-PK, p58, PKM, OIP3, PK2, PK3) (MaxLight 650) discontinued

Ask
View Details
Human Beta cellulin (bTC) ELISA Kit
MBS261692-01 48 Well

Human Beta cellulin (bTC) ELISA Kit

Ask
View Details
Human Beta cellulin (bTC) ELISA Kit
MBS261692-02 96 Well

Human Beta cellulin (bTC) ELISA Kit

Ask
View Details