Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin heavy variable 7-81 (HV781)

This Recombinant Human Probable non-functional immunoglobulin heavy variable 7-81 (HV781) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin heavy variable 7-81 IGHV7-81

UniProt

A0A0B4J1V7

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLVQSGHEVKQPGASVKVSCKASGYSFTTYGMNWVPQAPGQGLEWMGWFNTYTGNPTYAQGFTGRFVFSMDTSASTAYLQISSLKAEDMAMYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TXNDC9 Antibody
orb26320-01 50 µg

TXNDC9 Antibody

Sign In for Pricing
View Details
TXNDC9 Antibody
orb26320-02 100 µg

TXNDC9 Antibody

Sign In for Pricing
View Details
Odf4 Lentiviral Activation Particles (h2)
sc-414594-LAC-2 200 µL

Odf4 Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
Recombinant Streptococcus agalactiae Protein RecA (recA)
MBS1395459-01 0.02 mg (E-Coli)

Recombinant Streptococcus agalactiae Protein RecA (recA)

Sign In for Pricing
View Details
Recombinant Streptococcus agalactiae Protein RecA (recA)
MBS1395459-02 0.02 mg (Yeast)

Recombinant Streptococcus agalactiae Protein RecA (recA)

Sign In for Pricing
View Details
Recombinant Streptococcus agalactiae Protein RecA (recA)
MBS1395459-03 0.1 mg (E-Coli)

Recombinant Streptococcus agalactiae Protein RecA (recA)

Sign In for Pricing
View Details