Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 9-49 (LV949)

This Recombinant Human Immunoglobulin lambda variable 9-49 (LV949) spans the amino acid sequence from region 20-123. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 9-49 IGLV9-49

UniProt

A0A0B4J1Y8

Expression Region

20-123

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QPVLTQPPSASASLGASVTLTCTLSSGYSNYKVDWYQQRPGKGPRFVMRVGTGGIVGSKGDGIPDRFSVLGSGLNRYLTIKNIQEEDESDYHCGADHGSGSNFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MARCKS, Phosphorylated (S170) (Myristoylated Alanine-rich C-kinase Substrate, MACS, 80K-L, PKCSL, PRKCSL) (MaxLight 405)
MBS6426072-01 0.1 mL

MARCKS, Phosphorylated (S170) (Myristoylated Alanine-rich C-kinase Substrate, MACS, 80K-L, PKCSL, PRKCSL) (MaxLight 405)

Sign In for Pricing
View Details
MARCKS, Phosphorylated (S170) (Myristoylated Alanine-rich C-kinase Substrate, MACS, 80K-L, PKCSL, PRKCSL) (MaxLight 405)
MBS6426072-02 5x 0.1 mL

MARCKS, Phosphorylated (S170) (Myristoylated Alanine-rich C-kinase Substrate, MACS, 80K-L, PKCSL, PRKCSL) (MaxLight 405)

Sign In for Pricing
View Details
CALD1
CR399-1ml 1 mL

CALD1

Sign In for Pricing
View Details
GDF2 Knockout SKOV3 Polyclonal Cells
ARG12322 1 Million

GDF2 Knockout SKOV3 Polyclonal Cells

Sign In for Pricing
View Details
Heme Oxygenase 2 siRNA (h)
sc-35556 10 µM

Heme Oxygenase 2 siRNA (h)

Sign In for Pricing
View Details
Gigaxonin Lentiviral Activation Particles (h)
sc-407001-LAC 200 µL

Gigaxonin Lentiviral Activation Particles (h)

Sign In for Pricing
View Details