Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 13-2 (TVAM2)

This Recombinant Human T cell receptor alpha variable 13-2 (TVAM2) spans the amino acid sequence from region 22-113. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 13-2 TRAV13-2

UniProt

A0A0B4J235

Expression Region

22-113

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

ESVGLHLPTLSVQEGDNSIINCAYSNSASDYFIWYKQESGKGPQFIIDIRSNMDKRQGQRVTVLLNKTVKHLSLQIAATQPGDSAVYFCAEN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GABPA CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
21147154 3x 1.0 µg DNA

GABPA CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
TTC22 siRNA (Mouse)
orb1836480-01 15 nmol

TTC22 siRNA (Mouse)

Sign In for Pricing
View Details
TTC22 siRNA (Mouse)
orb1836480-02 30 nmol

TTC22 siRNA (Mouse)

Sign In for Pricing
View Details
SYT16, ID (SYT16, STREP14, SYT14L, SYT14R, Synaptotagmin-16, Chr14Syt, Synaptotagmin 14-like protein, Synaptotagmin XIV-related protein) (MaxLight 750) discontinued
042531-ML750 100 µL

SYT16, ID (SYT16, STREP14, SYT14L, SYT14R, Synaptotagmin-16, Chr14Syt, Synaptotagmin 14-like protein, Synaptotagmin XIV-related protein) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Mouse Monoclonal NONO Antibody (OTI4D9) [DyLight 488]
NBP2-73034G 0.1 mL

Mouse Monoclonal NONO Antibody (OTI4D9) [DyLight 488]

Sign In for Pricing
View Details
Phospho-c-Abl (Ser569) Polyclonal Antibody, AbBy Fluor™ 405 Conjugated
bs-12904R-BF405-01 20 µL

Phospho-c-Abl (Ser569) Polyclonal Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details