Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 10 (TVA10)

This Recombinant Human T cell receptor alpha variable 10 (TVA10) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 10 TRAV10

UniProt

A0A0B4J240

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KNQVEQSPQSLIILEGKNCTLQCNYTVSPFSNLRWYKQDTGRGPVSLTIMTFSENTKSNGRYTATLDADTKQSSLHITASQLSDSASYICVVS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rprml Antibody
orb861082 2 mg

Rprml Antibody

Sign In for Pricing
View Details
PRAC1 Polyclonal Antibody
A67110-050 50 µL

PRAC1 Polyclonal Antibody

Sign In for Pricing
View Details
Rhesus Monkey Small Intestine (Ileum) cDNA-Random Primer
NHP-cDP062 Each

Rhesus Monkey Small Intestine (Ileum) cDNA-Random Primer

Sign In for Pricing
View Details
VASH1 Recombinant Rabbit mAb
E43S48370 100 µL

VASH1 Recombinant Rabbit mAb

Sign In for Pricing
View Details
MiRP1 Lentiviral Activation Particles (m)
sc-434199-LAC 200 µL

MiRP1 Lentiviral Activation Particles (m)

Sign In for Pricing
View Details
DDX5 Mouse Monoclonal Antibody (Biotin)
orb2606882 100 µg

DDX5 Mouse Monoclonal Antibody (Biotin)

Sign In for Pricing
View Details