Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 13-1 (TVAM1)

This Recombinant Human T cell receptor alpha variable 13-1 (TVAM1) spans the amino acid sequence from region 21-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 13-1 TRAV13-1

UniProt

A0A0B4J241

Expression Region

21-112

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

ENVEQHPSTLSVQEGDSAVIKCTYSDSASNYFPWYKQELGKGPQLIIDIRSNVGEKKDQRIAVTLNKTAKHFSLHITETQPEDSAVYFCAAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal SARDH Antibody
NBP2-31668 0.1 mL

Rabbit Polyclonal SARDH Antibody

Sign In for Pricing
View Details
GENLISA Hamster Triiodothyronine (T3) ELISA
KLH1083 1x 96 Well

GENLISA Hamster Triiodothyronine (T3) ELISA

Sign In for Pricing
View Details
Carrier-free (BSA/glycerol-free) CK18 mouse monoclonal antibody, clone OTI1H10 (formerly 1H10)
CF500017 100 µg

Carrier-free (BSA/glycerol-free) CK18 mouse monoclonal antibody, clone OTI1H10 (formerly 1H10)

Sign In for Pricing
View Details
MEF2A Rabbit Polyclonal Antibody
orb329913 100 µL

MEF2A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Donanemab (Mouse IgG2b)
T9901A-752-01 10 mg

Donanemab (Mouse IgG2b)

Sign In for Pricing
View Details
Donanemab (Mouse IgG2b)
T9901A-752-02 1 mg

Donanemab (Mouse IgG2b)

Sign In for Pricing
View Details