Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 13-1 (TVAM1)

This Recombinant Human T cell receptor alpha variable 13-1 (TVAM1) spans the amino acid sequence from region 21-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 13-1 TRAV13-1

UniProt

A0A0B4J241

Expression Region

21-112

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

ENVEQHPSTLSVQEGDSAVIKCTYSDSASNYFPWYKQELGKGPQLIIDIRSNVGEKKDQRIAVTLNKTAKHFSLHITETQPEDSAVYFCAAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat adenosine deaminase,ADA ELISA KIT
JOT-EK6280Ra-01 96 Well

Rat adenosine deaminase,ADA ELISA KIT

Sign In for Pricing
View Details
Rat adenosine deaminase,ADA ELISA KIT
JOT-EK6280Ra-02 48 Well

Rat adenosine deaminase,ADA ELISA KIT

Sign In for Pricing
View Details
GTF2A1L Peptide - C-terminal region
MBS3236497-01 0.1 mg

GTF2A1L Peptide - C-terminal region

Sign In for Pricing
View Details
GTF2A1L Peptide - C-terminal region
MBS3236497-02 5x 0.1 mg

GTF2A1L Peptide - C-terminal region

Sign In for Pricing
View Details
Rabbit Polyclonal Zika Virus IgG Antibody [DyLight 350]
NBP2-61133UV 0.1 mL

Rabbit Polyclonal Zika Virus IgG Antibody [DyLight 350]

Sign In for Pricing
View Details
Phospho-Smad1 (Ser463/Ser465) (15L6) Rabbit Monoclonal Antibody
E28M3119 100 µL

Phospho-Smad1 (Ser463/Ser465) (15L6) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details