Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 13-1 (TVAM1)

This Recombinant Human T cell receptor alpha variable 13-1 (TVAM1) spans the amino acid sequence from region 21-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 13-1 TRAV13-1

UniProt

A0A0B4J241

Expression Region

21-112

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

ENVEQHPSTLSVQEGDSAVIKCTYSDSASNYFPWYKQELGKGPQLIIDIRSNVGEKKDQRIAVTLNKTAKHFSLHITETQPEDSAVYFCAAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CECR5 siRNA Oligos set (Human)
15842171 3x 5 nmol

CECR5 siRNA Oligos set (Human)

Sign In for Pricing
View Details
TSPAN2, NT (TSPAN2, Tetraspanin-2, Tetraspan NET-3) (FITC)
MBS6359587-01 0.2 mL

TSPAN2, NT (TSPAN2, Tetraspanin-2, Tetraspan NET-3) (FITC)

Sign In for Pricing
View Details
TSPAN2, NT (TSPAN2, Tetraspanin-2, Tetraspan NET-3) (FITC)
MBS6359587-02 5x 0.2 mL

TSPAN2, NT (TSPAN2, Tetraspanin-2, Tetraspan NET-3) (FITC)

Sign In for Pricing
View Details
Recombinant Mesomycoplasma hyopneumoniae 46 kDa surface antigen (p46)
orb2659422-01 20 µg

Recombinant Mesomycoplasma hyopneumoniae 46 kDa surface antigen (p46)

Sign In for Pricing
View Details
Recombinant Mesomycoplasma hyopneumoniae 46 kDa surface antigen (p46)
orb2659422-02 100 µg

Recombinant Mesomycoplasma hyopneumoniae 46 kDa surface antigen (p46)

Sign In for Pricing
View Details
Recombinant Mesomycoplasma hyopneumoniae 46 kDa surface antigen (p46)
orb2659422-03 1 mg

Recombinant Mesomycoplasma hyopneumoniae 46 kDa surface antigen (p46)

Sign In for Pricing
View Details