Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 3 (TVA3)

This Recombinant Human T cell receptor alpha variable 3 (TVA3) spans the amino acid sequence from region 21-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 3 TRAV3

UniProt

A0A0B4J244

Expression Region

21-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QSVAQPEDQVNVAEGNPLTVKCTYSVSGNPYLFWYVQYPNRGLQFLLKYITGDNLVKGSYGFEAEFNKSQTSFHLKKPSALVSDSALYFCAVRD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NGAL (human) monoclonal antibody (26)
BPD-ABS-038-26-04 400 µg

NGAL (human) monoclonal antibody (26)

Sign In for Pricing
View Details
Mouse Matrix Metalloproteinase 8 (MMP8) ELISA Kit
orb776397-01 48 Tests

Mouse Matrix Metalloproteinase 8 (MMP8) ELISA Kit

Sign In for Pricing
View Details
Mouse Matrix Metalloproteinase 8 (MMP8) ELISA Kit
orb776397-02 96 Tests

Mouse Matrix Metalloproteinase 8 (MMP8) ELISA Kit

Sign In for Pricing
View Details
PrecisionFASTTM-LR qPCR MasterMix (with LOW ROX; w/ SYBRgreen)
368523-01 1 mL

PrecisionFASTTM-LR qPCR MasterMix (with LOW ROX; w/ SYBRgreen)

Sign In for Pricing
View Details
PrecisionFASTTM-LR qPCR MasterMix (with LOW ROX; w/ SYBRgreen)
368523-02 2 mL

PrecisionFASTTM-LR qPCR MasterMix (with LOW ROX; w/ SYBRgreen)

Sign In for Pricing
View Details
PrecisionFASTTM-LR qPCR MasterMix (with LOW ROX; w/ SYBRgreen)
368523-03 5 mL

PrecisionFASTTM-LR qPCR MasterMix (with LOW ROX; w/ SYBRgreen)

Sign In for Pricing
View Details