Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 3 (TVA3)

This Recombinant Human T cell receptor alpha variable 3 (TVA3) spans the amino acid sequence from region 21-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 3 TRAV3

UniProt

A0A0B4J244

Expression Region

21-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QSVAQPEDQVNVAEGNPLTVKCTYSVSGNPYLFWYVQYPNRGLQFLLKYITGDNLVKGSYGFEAEFNKSQTSFHLKKPSALVSDSALYFCAVRD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Aqp1 Mouse Gene Knockout Kit (CRISPR)
KN501448 1 Kit

Aqp1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MYD88
CSB-CL859945HU 10 μg Plasmid + 200 μL Glycerol

MYD88

Sign In for Pricing
View Details
Hey1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
23227114 3x 1.0 µg

Hey1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Caspase-9 Polyclonal Antibody, APC Conjugated
bs-0050R-APC-TR 20 µL

Caspase-9 Polyclonal Antibody, APC Conjugated

Sign In for Pricing
View Details
HCMV pp65 Rabbit Polyclonal Antibody (RBITC)
orb1054696 100 µL

HCMV pp65 Rabbit Polyclonal Antibody (RBITC)

Sign In for Pricing
View Details
PPM1H Protein Vector (Mouse) (pPM-C-HA)
PV218420 500 ng

PPM1H Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details