Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 12-1 (TVAL1)

This Recombinant Human T cell receptor alpha variable 12-1 (TVAL1) spans the amino acid sequence from region 21-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 12-1 TRAV12-1

UniProt

A0A0B4J245

Expression Region

21-112

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QRKEVEQDPGPFNVPEGATVAFNCTYSNSASQSFFWYRQDCRKEPKLLMSVYSSGNEDGRFTAQLNRASQYISLLIRDSKLSDSATYLCVVN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ninjurin-2 Double Nickase Plasmid (m)
sc-424365-NIC 20 µg

Ninjurin-2 Double Nickase Plasmid (m)

Sign In for Pricing
View Details
SMN1/2 Antibody
orb1177299 100 µg

SMN1/2 Antibody

Sign In for Pricing
View Details
WSB2 Protein Vector (Rat) (pPM-C-HA)
PV316732 500 ng

WSB2 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
5-HT2B antagonist-1
BUP13545-01 10 mg

5-HT2B antagonist-1

Sign In for Pricing
View Details
5-HT2B antagonist-1
BUP13545-02 25 mg

5-HT2B antagonist-1

Sign In for Pricing
View Details
5-HT2B antagonist-1
BUP13545-03 50 mg

5-HT2B antagonist-1

Sign In for Pricing
View Details