Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 12-1 (TVAL1)

This Recombinant Human T cell receptor alpha variable 12-1 (TVAL1) spans the amino acid sequence from region 21-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 12-1 TRAV12-1

UniProt

A0A0B4J245

Expression Region

21-112

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QRKEVEQDPGPFNVPEGATVAFNCTYSNSASQSFFWYRQDCRKEPKLLMSVYSSGNEDGRFTAQLNRASQYISLLIRDSKLSDSATYLCVVN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gzmk sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K6907005 3x 1.0 µg

Gzmk sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
TRMT6 Antibody; FITC conjugated
MBS7005067-01 0.05 mg

TRMT6 Antibody; FITC conjugated

Sign In for Pricing
View Details
TRMT6 Antibody; FITC conjugated
MBS7005067-02 0.1 mg

TRMT6 Antibody; FITC conjugated

Sign In for Pricing
View Details
TRMT6 Antibody; FITC conjugated
MBS7005067-03 5x 0.1 mg

TRMT6 Antibody; FITC conjugated

Sign In for Pricing
View Details
Pde1b (NM_022710) Rat Tagged ORF Clone Lentiviral Particle
RR205735L3V 200 µL

Pde1b (NM_022710) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
DDX11L4 3'UTR Luciferase Stable Cell Line
TU005686 1.0 mL

DDX11L4 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details