Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 8-6 (TVA86)

This Recombinant Human T cell receptor alpha variable 8-6 (TVA86) spans the amino acid sequence from region 21-113. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 8-6 TRAV8-6

UniProt

A0A0B4J262

Expression Region

21-113

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QSVTQLDSQVPVFEEAPVELRCNYSSSVSVYLFWYVQYPNQGLQLLLKYLSGSTLVESINGFEAEFNKSQTSFHLRKPSVHISDTAEYFCAVS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Factor D (CFD) (N-term) Rabbit Polyclonal Antibody
AP50877PU-N 400 µL

Factor D (CFD) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tchhl1 Mouse Gene Knockout Kit (CRISPR)
KN517332 1 Kit

Tchhl1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human CHRNA9 activation kit by CRISPRa
GA110802 1 Kit

Human CHRNA9 activation kit by CRISPRa

Sign In for Pricing
View Details
Carbaryl
TRC-C175895-500MG 500 mg

Carbaryl

Sign In for Pricing
View Details
UGT2B10 (NM_001075) Human Recombinant Protein
TP323408M 100 µg

UGT2B10 (NM_001075) Human Recombinant Protein

Sign In for Pricing
View Details
2′-Deoxyuridine 4-oxime
TRC-D308930-100MG 100 mg

2′-Deoxyuridine 4-oxime

Sign In for Pricing
View Details