Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 8-6 (TVA86)

This Recombinant Human T cell receptor alpha variable 8-6 (TVA86) spans the amino acid sequence from region 21-113. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 8-6 TRAV8-6

UniProt

A0A0B4J262

Expression Region

21-113

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QSVTQLDSQVPVFEEAPVELRCNYSSSVSVYLFWYVQYPNQGLQLLLKYLSGSTLVESINGFEAEFNKSQTSFHLRKPSVHISDTAEYFCAVS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FZD2 Rabbit Polyclonal Antibody
HA500406 100 µL

FZD2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human DKK1 activation kit by CRISPRa
GA107930 1 Kit

Human DKK1 activation kit by CRISPRa

Sign In for Pricing
View Details
Human TRPT1 activation kit by CRISPRa
GA113244 1 Kit

Human TRPT1 activation kit by CRISPRa

Sign In for Pricing
View Details
SRRP35 (SRSF12) Human qPCR Primer Pair (NM_080743)
HP216738 200 Reactions

SRRP35 (SRSF12) Human qPCR Primer Pair (NM_080743)

Sign In for Pricing
View Details
Rab8a (NM_023126) Mouse Tagged ORF Clone
MG202203 10 µg

Rab8a (NM_023126) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Forsythoside A
TRC-F702000-25MG 25 mg

Forsythoside A

Sign In for Pricing
View Details