Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 8-6 (TVA86)

This Recombinant Human T cell receptor alpha variable 8-6 (TVA86) spans the amino acid sequence from region 21-113. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 8-6 TRAV8-6

UniProt

A0A0B4J262

Expression Region

21-113

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QSVTQLDSQVPVFEEAPVELRCNYSSSVSVYLFWYVQYPNQGLQLLLKYLSGSTLVESINGFEAEFNKSQTSFHLRKPSVHISDTAEYFCAVS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WDR87 Lentiviral Activation Particles (h2)
sc-413522-LAC-2 200 µL

WDR87 Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
GPR1 Protein Lysate (Human) with C-Ha Tag
22480031 100 µg

GPR1 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
anti-ARMET
YF-PA15487 50 ug

anti-ARMET

Sign In for Pricing
View Details
IGHD4OR15-4B siRNA Oligos set (Human)
24365171 3x 5 nmol

IGHD4OR15-4B siRNA Oligos set (Human)

Sign In for Pricing
View Details
Metalloproteinase Inhibitor 2 (TIMP2) Antibody
abx174811 1 mL

Metalloproteinase Inhibitor 2 (TIMP2) Antibody

Sign In for Pricing
View Details
Lentiviral mouse Slpi shRNA (UAS) - Lentiviral mouseSlpi shRNA (UAS, GFP) (25)
GTR15266348 1 Vial

Lentiviral mouse Slpi shRNA (UAS) - Lentiviral mouseSlpi shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details