Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 38-1 (TV381)

This Recombinant Human T cell receptor alpha variable 38-1 (TV381) spans the amino acid sequence from region 22-116. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 38-1 TRAV38-1

UniProt

A0A0B4J264

Expression Region

22-116

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QTVTQSQPEMSVQEAETVTLSCTYDTSENNYYLFWYKQPPSRQMILVIRQEAYKQQNATENRFSVNFQKAAKSFSLKISDSQLGDTAMYFCAFMK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Butanoic-d7 Acid
TRC-B692237-500MG 500 mg

Butanoic-d7 Acid

Sign In for Pricing
View Details
Calnexin (Endoplasmic Reticulum Marker) (CANX/1541), CF594 conjugate, 0.1mg/mL
BNC941541-500 1x 500 µL

Calnexin (Endoplasmic Reticulum Marker) (CANX/1541), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Ovary
CS801001 5x 5 µm

Tissue FFPE Sections, Ovary

Sign In for Pricing
View Details
Frozen Tissue Sections, Breast
CS644462 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details
Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (IGHM/3776R), CF405S conjugate, 0.1mg/mL
BNC043776-500 1x 500 µL

Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (IGHM/3776R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GUCA2A Antibody
KC-2584-01 50 μL

GUCA2A Antibody

Sign In for Pricing
View Details