Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 12-3 (TVAL3)

This Recombinant Human T cell receptor alpha variable 12-3 (TVAL3) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 12-3 TRAV12-3

UniProt

A0A0B4J271

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QQKEVEQDPGPLSVPEGAIVSLNCTYSNSAFQYFMWYRQYSRKGPELLMYTYSSGNKEDGRFTAQVDKSSKYISLFIRDSQPSDSATYLCAMS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine 17 Hydroxypregnenolone ELISA kit
GTR10382538 96 Well

Canine 17 Hydroxypregnenolone ELISA kit

Sign In for Pricing
View Details
Estrogen Related Receptor beta Rabbit pAb, PerCP-Cy7 conjugated
orb2850928 100 µL

Estrogen Related Receptor beta Rabbit pAb, PerCP-Cy7 conjugated

Sign In for Pricing
View Details
ER81 (ETV1) (NM_001163147) Human Untagged Clone
SC327004 10 µg

ER81 (ETV1) (NM_001163147) Human Untagged Clone

Sign In for Pricing
View Details
Thrombin protein
30-1215 0.25 KU

Thrombin protein

Sign In for Pricing
View Details
Mouse Uprt qPCR Primer Pair
QM71782S 200 Tests

Mouse Uprt qPCR Primer Pair

Sign In for Pricing
View Details
EPHA2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
19355061 1.0 µg DNA

EPHA2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details