Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 24 (TVA24)

This Recombinant Human T cell receptor alpha variable 24 (TVA24) spans the amino acid sequence from region 23-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 24 TRAV24

UniProt

A0A0B4J272

Expression Region

23-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

ILNVEQSPQSLHVQEGDSTNFTCSFPSSNFYALHWYRWETAKSPEALFVMTLNGDEKKKGRISATLNTKEGYSYLYIKGSQPEDSATYLCAF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LentimiRa-Off-hsa-miR-4708-5p Vector
mh31667 500 ng

LentimiRa-Off-hsa-miR-4708-5p Vector

Sign In for Pricing
View Details
ASXL1 siRNA (Mouse)
CRN2680-01 15 nmol

ASXL1 siRNA (Mouse)

Sign In for Pricing
View Details
ASXL1 siRNA (Mouse)
CRN2680-02 30 nmol

ASXL1 siRNA (Mouse)

Sign In for Pricing
View Details
SLC25A19 Protein Vector (Human) (pPM-C-HA)
PV129596 500 ng

SLC25A19 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
ZAN Polyclonal Antibody, AbBy Fluor™ 488 Conjugated
bs-13547R-BF488 100 µL

ZAN Polyclonal Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
Rat Calb1 ELISA Kit
EF017283 96 Tests

Rat Calb1 ELISA Kit

Sign In for Pricing
View Details