Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 34 (TVA34)

This Recombinant Human T cell receptor alpha variable 34 (TVA34) spans the amino acid sequence from region 22-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 34 TRAV34

UniProt

A0A0B4J273

Expression Region

22-112

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QELEQSPQSLIVQEGKNLTINCTSSKTLYGLYWYKQKYGEGLIFLMMLQKGGEEKSHEKITAKLDEKKQQSSLHITASQPSHAGIYLCGAD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDCD1 / PD1 / CD279 (Programmed Cell Death 1), CF405S conjugate, 0.1mg/mL
BNC041457-500 1x 500 µL

PDCD1 / PD1 / CD279 (Programmed Cell Death 1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Thymidylate Synthase (5-FU Resistance Marker) (rTYMS/1884), Biotin conjugate, 0.1mg/mL
BNCB3812-500 1x 500 µL

Thymidylate Synthase (5-FU Resistance Marker) (rTYMS/1884), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Mouse Trefoil Factor 2/TFF2 Protein (His Tag)
PKSM041268-01 10 µg

Recombinant Mouse Trefoil Factor 2/TFF2 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse Trefoil Factor 2/TFF2 Protein (His Tag)
PKSM041268-02 50 µg

Recombinant Mouse Trefoil Factor 2/TFF2 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant TMPRSS2 Monoclonal Antibody
AN301677L-01 50 µL

Recombinant TMPRSS2 Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant TMPRSS2 Monoclonal Antibody
AN301677L-02 100 µL

Recombinant TMPRSS2 Monoclonal Antibody

Sign In for Pricing
View Details