Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 34 (TVA34)

This Recombinant Human T cell receptor alpha variable 34 (TVA34) spans the amino acid sequence from region 22-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 34 TRAV34

UniProt

A0A0B4J273

Expression Region

22-112

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QELEQSPQSLIVQEGKNLTINCTSSKTLYGLYWYKQKYGEGLIFLMMLQKGGEEKSHEKITAKLDEKKQQSSLHITASQPSHAGIYLCGAD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPP2R5C, CT (PPP2R5C, KIAA0044, Serine/threonine-protein phosphatase 2A 56kD regulatory subunit gamma isoform, PP2A B subunit isoform B'-gamma, PP2A B subunit isoform B56-gamma, PP2A B subunit isoform PR61-gamma, PP2A B subunit isoform R5-gamma, Renal carcinoma antigen NY-REN-29) (MaxLight 405) discontinued
040356-ML405 100 µL

PPP2R5C, CT (PPP2R5C, KIAA0044, Serine/threonine-protein phosphatase 2A 56kD regulatory subunit gamma isoform, PP2A B subunit isoform B'-gamma, PP2A B subunit isoform B56-gamma, PP2A B subunit isoform PR61-gamma, PP2A B subunit isoform R5-gamma, Renal carcinoma antigen NY-REN-29) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Vimentin mouse mAb (ABT384)
RA12257-01 50 µL

Vimentin mouse mAb (ABT384)

Sign In for Pricing
View Details
Vimentin mouse mAb (ABT384)
RA12257-02 100 µL

Vimentin mouse mAb (ABT384)

Sign In for Pricing
View Details
AZD5904
E2989-5mg 5 mg

AZD5904

Sign In for Pricing
View Details
ARPC1A Antibody
orb1248739 0.1 mg

ARPC1A Antibody

Sign In for Pricing
View Details
Uap1l1 Rabbit Polyclonal Antibody (Biotin)
orb2113363 100 µL

Uap1l1 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details